HORDB

ID: hor004749
Uniprot ID: Q8S8I4
Protein name: MEPF1
Gene name: EPF1
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
Source: Plant
Expression: Not induced by high CO(2). |Expressed in shoots, but not in roots. Mostly localized in developing leaves, specifically in meristemoids, guard mother cells (GMCs), and young guard cells.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003674 molecular_function
GO BP: GO:0010374 stomatal complex development; GO:0010375 stomatal complex patterning; GO:2000122 negative regulation of stomatal complex development
GO CC: GO:0005576 extracellular region

Sequence: AGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP
Length: 52(53-104)
Propeptide: MKSLLLLAFFLSFFFGSLLARHLPTSSHPSHHHVGMTGALKRQRRRPDTVQVAGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP
Signal peptide: MKSLLLLAFFLSFFFGSLLA
Modification: NA
Glycosylation: T46 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Controls stomatal patterning. Regulates asymmetric cell division during guard cell differentiation. Mediates stomatal development inhibition. Not cleaved by the protease CRSP (AC Q9LNU1).mobile signal controlling stomatal development in a non-cell-autonom
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004749_AF2.pdb

hor004749_ESM.pdb

Mass:	644431	Formula:	C229H364N64O73S11
Absent amino acids:	IQW	Common amino acids:	CS
pI:	6.97	Basic residues:	5
Polar residues:	22	Hydrophobic residues:	13
Hydrophobicity:	14.23	Boman Index:	-5344
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	52.5
Instability Index:	6898.46	Extinction Coefficient cystines:	3480
Absorbance 280nm:	68.24

PubMed ID: 17639078
Title: The Secretory Peptide Gene EPF1 Enforces the Stomatal One-Cell-Spacing Rule
PubMed ID: 22241782
Title: Direct Interaction of Ligand-Receptor Pairs Specifying Stomatal Patterning
PubMed ID: 22027592
Title: The NMR Structure of Stomagen Reveals the Basis of Stomatal Density Regulation by Plant Peptide Ho